DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and IGSF9B

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:422 Identity:98/422 - (23%)
Similarity:146/422 - (34%) Gaps:155/422 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VVASVGDSVEFNCTV--EEVGQ---LSVSWAKRPSESDTNSVVLSMRNILSLP------------ 89
            |.|..|:||...|.|  ...||   ..|.|.|                 ..:|            
Human    33 VTARAGESVVLRCDVIHPVTGQPPPYVVEWFK-----------------FGVPIPIFIKFGYYPP 80

  Fly    90 --DQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVT----KKLSLQIKTPPV 148
              |..|....:...|.     :.|::.:...|.|.|||:||:...:..|    ..:.|.|..||.
Human    81 HVDPEYAGRASLHDKA-----SLRLEQVRSEDQGWYECKV
LMLDQQYDTFHNGSWVHLTINAPPT 140

  Fly   149 IAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMDRGG 213
            ..|..|:.....||.::.:||.|.|.|||.::|.:|...:..:|.:.:::.:|.:.||.|.|||.
Human   141 FTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTLLGASGKYQVSDGSLTVTSVSREDRGA 205

  Fly   214 YYCIAQNGEG------------------------------------------------------- 223
            |.|.|.:.:|                                                       
Human   206 YTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITVNISQDALLTCRAEAYPGNLTYTWYWQDENV 270

  Fly   224 --QPDKRL-IRVEVE-----FR--PQ----------------------IAVQRP-KIAQM----- 250
              |.|.:| :|:.::     ||  |:                      :.||.| ::..|     
Human   271 YFQNDLKLRVRILIDGTLIIFRVKPEDSGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIY 335

  Fly   251 --VSHSAELECSVQGYPAPTVV-WHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGD 312
              |.....:.|.|...|..||| |:|:|.|||..::  :..|....|:    :||:...||..|.
Human   336 VPVGIHGYIRCPVDAEPPATVVKWNKDGRPLQVEKN--LGWTLMEDGS----IRIEEATEEALGT 394

  Fly   313 YYCNATNKLG----HADARLHL----FQTVIP 336
            |.|...|.||    .|.|||.|    :.||:|
Human   395 YTCVPYNTLGTMGQSAPARLVLKDPPYFTVLP 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 26/123 (21%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..68 CDD:409353 2/4 (50%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 1/6 (17%)
Ig_3 146..220 CDD:464046 26/73 (36%)
I-set 254..330 CDD:400151 28/80 (35%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 268..272 CDD:409353 3/4 (75%)
Ig strand E 298..302 CDD:409353 0/3 (0%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 22/103 (21%)
Ig strand B 41..45 CDD:409353 1/3 (33%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 96..100 CDD:409353 0/8 (0%)
Ig strand F 110..115 CDD:409353 3/4 (75%)
I-set 139..225 CDD:400151 26/85 (31%)
Ig strand B 157..161 CDD:409353 0/3 (0%)
Ig strand C 170..174 CDD:409353 0/3 (0%)
Ig strand E 191..195 CDD:409353 1/3 (33%)
Ig strand F 205..210 CDD:409353 2/4 (50%)
Ig strand G 218..221 CDD:409353 0/2 (0%)
Ig_3 228..307 CDD:464046 7/78 (9%)
Ig 336..410 CDD:472250 25/79 (32%)
Ig strand B 342..346 CDD:409353 0/3 (0%)
Ig strand C 355..360 CDD:409353 3/4 (75%)
Ig strand E 380..384 CDD:409353 1/7 (14%)
Ig strand F 394..399 CDD:409353 2/4 (50%)
Ig strand G 407..410 CDD:409353 0/2 (0%)
Ig 429..505 CDD:472250
Ig strand B 438..442 CDD:409353
Ig strand C 451..455 CDD:409353
Ig strand E 471..475 CDD:409353
Ig strand F 485..490 CDD:409353
FN3 <490..>731 CDD:442628
Ig strand G 498..501 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
PHA03247 <894..1242 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.