DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and Iglon5

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:342 Identity:87/342 - (25%)
Similarity:136/342 - (39%) Gaps:60/342 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ARLRLLIGLIFC-LAISLDSVLSAPV-ISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSE 72
            ||||||...... ||:....:||..: .|..:.:.....||:...:|.::| ....|:|      
Mouse     8 ARLRLLAAAALAGLAVISRGLLSQSLEFSSPADNYTVCEGDNATLSCFIDE-HVTRVAW------ 65

  Fly    73 SDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAI-----YTFRIQNIEVSDMGPYECQVLVSAT 132
                   |:..|||...:.|:    |..|:....|     ::..|..:.:.|.|.|.|. ..:..
Mouse    66 -------LNRSNILYAGNDRW----TSDPRVRLLINTPEEFSILITQVGLGDEGLYTCS-FQTRH 118

  Fly   133 EKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLA 197
            :..|.::.|.:..|..|. |......|.||.|:.|.|.|.|.|:||::|.:..:.....|     
Mouse   119 QPYTTQVYLIVHVPARIV-NISSPVAVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEG----- 177

  Fly   198 EPTLRIRSVHRMDRGGYYCIAQNG-EGQPDKRLIRVEVEFRPQIA-VQRPKIAQMVSHSAELECS 260
             ..|.|..:.|...|.|.|:..|| ...||.|.:.|.|.:.|.|. |...:.|  :..:|.|.|.
Mouse   178 -EILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTA--LGRAALLRCE 239

  Fly   261 VQGYPAPTVVWHKN----------GVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYC 315
            ....|.....|:|:          |:.:|:.|             |.|:|...:|....:|:|.|
Mouse   240 AMAVPPADFQWYKDDRLLSSGSAEGLKVQTER-------------TRSMLLFANVSARHYGNYTC 291

  Fly   316 NATNKLGHADARLHLFQ 332
            .|.|:||.:.|.:.|.:
Mouse   292 RAANRLGASSASMRLLR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 22/115 (19%)
Ig 37..127 CDD:299845 19/94 (20%)
IG_like 154..234 CDD:214653 25/80 (31%)
IGc2 161..223 CDD:197706 20/62 (32%)
I-set 254..330 CDD:254352 21/85 (25%)
IGc2 254..322 CDD:197706 18/77 (23%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 21/106 (20%)
Ig strand A' 41..46 CDD:409353 0/4 (0%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 1/4 (25%)
FR2 61..68 CDD:409353 3/19 (16%)
Ig strand C 61..67 CDD:409353 2/18 (11%)
CDR2 69..79 CDD:409353 3/9 (33%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 8/35 (23%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/8 (38%)
CDR3 116..120 CDD:409353 0/3 (0%)
Ig strand G 120..129 CDD:409353 2/8 (25%)
FR4 122..129 CDD:409353 2/6 (33%)
Ig strand A 132..137 CDD:409353 2/5 (40%)
Ig_3 134..199 CDD:404760 21/71 (30%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 1/4 (25%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760 21/92 (23%)
putative Ig strand A 218..224 CDD:409353 2/5 (40%)
Ig strand B 234..238 CDD:409353 2/3 (67%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833588
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR42757
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.