DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and CADM4

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_660339.1 Gene:CADM4 / 199731 HGNCID:30825 Length:388 Species:Homo sapiens


Alignment Length:319 Identity:75/319 - (23%)
Similarity:122/319 - (38%) Gaps:55/319 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SKDVVASVGDSVEFNCTVEEV-GQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPK 102
            :::|..:.|...|..|.:.:. |.:.|  .:.|:..     .|......:|.|:|:.:......:
Human    29 TENVTVAEGGVAEITCRLHQYDGSIVV--IQNPARQ-----TLFFNGTRALKDERFQLEEFSPRR 86

  Fly   103 TGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLV------TE 161
            .     ..|:.:..:.|.|.|.||:....|..       ||.|..|:.  .|::.:|      .|
Human    87 V-----RIRLSDARLEDEGGYFCQLYTEDTHH-------QIATLTVLV--APENPVVEVREQAVE 137

  Fly   162 GQNLELTCHA-NGFPKPTISWAREH------NAVMPAGGHLLAEPTLRIRSVHRMDRGG-YYCIA 218
            |..:||:|.. ...|..|:.|.|:.      ::....|.......|:|.| |.|.|.|| ..|.|
Human   138 GGEVELSCLVPRSRPAATLRWYRDRKELKGVSSSQENGKVWSVASTVRFR-VDRKDDGGIIICEA 201

  Fly   219 QN---GEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVV-WHKNGVPLQ 279
            ||   ..|...:....::|::.|...:...:.......:..|.|:|.|.|.|..: |::....| 
Human   202 QNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESL- 265

  Fly   280 SSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHLFQTVIPVP 338
            ..|...|..|.:..|..::          |.|.|.|.|:||.|||.|   |:..|:..|
Human   266 PERAEAVGETLTLPGLVSA----------DNGTYTCEASNKHGHARA---LYVLVVYDP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 18/104 (17%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..68 CDD:409353 1/4 (25%)
Ig strand E 101..112 CDD:409353 0/10 (0%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 23/87 (26%)
I-set 254..330 CDD:400151 23/76 (30%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/4 (0%)
Ig strand E 298..302 CDD:409353 0/3 (0%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
CADM4NP_660339.1 Ig 29..120 CDD:472250 21/109 (19%)
Ig strand B 40..44 CDD:409353 1/3 (33%)
Ig strand C 53..57 CDD:409353 1/5 (20%)
Ig strand E 87..91 CDD:409353 0/8 (0%)
Ig strand F 101..106 CDD:409353 2/4 (50%)
Ig strand G 113..116 CDD:409353 1/9 (11%)
IgI_2_Necl-4 121..220 CDD:409468 25/101 (25%)
Ig strand A 121..124 CDD:409468 0/4 (0%)
Ig strand A' 127..131 CDD:409468 1/3 (33%)
Ig strand B 139..149 CDD:409468 3/9 (33%)
Ig strand C 152..161 CDD:409468 3/8 (38%)
Ig strand C' 162..165 CDD:409468 0/2 (0%)
Ig strand D 167..174 CDD:409468 0/6 (0%)
Ig strand E 177..187 CDD:409468 2/9 (22%)
Ig strand F 195..203 CDD:409468 3/7 (43%)
Ig strand G 212..219 CDD:409468 0/6 (0%)
Ig_3 224..295 CDD:464046 18/81 (22%)
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.