DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and zig-3

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:262 Identity:58/262 - (22%)
Similarity:94/262 - (35%) Gaps:58/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLIGLIFCLAISLDSVLSAPVISQIS-----------------------KDVVASVGDSVEFNCT 55
            |||.:....|||...:.|..:.:.:|                       :|...|.|:||...|.
 Worm     2 LLICISVLAAISAHPLSSGEMRAAVSNLVREIDSTHLTTKPSLKIIEGLEDNTVSTGESVTLRCD 66

  Fly    56 VEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYT--FRIQNIEVS 118
            |.......:.|.|.......:..:.....:|:          ..||...|.|.|  ::|....:.
 Worm    67 VLSTPTGVIYWEKDGQRIQGDKELNVFEKVLN----------AMGPTVESGIITSSYQIPCANLH 121

  Fly   119 DMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKS----TLVTEGQ-NLE-----LTCHANG 173
            .:|.|:| |..:..:.|.....:.::...|..::|.:|    |:.||.: .|:     |.|.|: 
 Worm   122 HIGSYKC-VATNGHDTVESSAKISVEGQTVKCKSTRRSAPVITMSTESRFELQDNAATLICRAD- 184

  Fly   174 FPKPTISWAREHNAVMPAGG--HLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQ--------PDKR 228
             .:...:|..|...:....|  .||....|.||.:...|.|.|:|||.|..|:        |.|:
 Worm   185 -RRANWNWMFEDKKIDFDSGRYELLPSGDLLIRKIQWSDMGSYFCIAHNKYGESRGETFLYPTKK 248

  Fly   229 LI 230
            .|
 Worm   249 HI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 22/134 (16%)
Ig 37..127 CDD:299845 20/114 (18%)
IG_like 154..234 CDD:214653 27/97 (28%)
IGc2 161..223 CDD:197706 20/69 (29%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
zig-3NP_509336.1 I-set 45..145 CDD:254352 21/110 (19%)
Ig 61..142 CDD:143165 17/91 (19%)
IG_like 177..244 CDD:214653 19/68 (28%)
Ig <191..237 CDD:299845 16/45 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.