DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and zig-2

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:256 Identity:59/256 - (23%)
Similarity:92/256 - (35%) Gaps:77/256 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 VLVSATEKVTKKLSLQ-IKTPPVIA-ENTPKSTLVTEGQNLELTCHANGFPKPTISW-------- 181
            ||::|.|.|..:..:: :.:.|::. ..||..:.||.|:...|:|.|||.|.|:|.|        
 Worm    10 VLLNAAESVDHQKPIRALDSQPLLKFTRTPNDSNVTFGEKFVLSCGANGAPLPSIYWELNGMRIQ 74

  Fly   182 ---------------AREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNG---------- 221
                           .:..||.|.:..:.:...|.|       :.|.|.||..||          
 Worm    75 GEETSNVYENILNDGKQVSNAAMVSSHYRIPCATAR-------NSGAYKCIIDNGLTKLEHVAKV 132

  Fly   222 -------------EGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHK 273
                         .|.|   .|.:.|:||.:|:          :::..|.|  :...|....|||
 Worm   133 FVGGNKTNCALNDNGAP---FISMTVDFRLEIS----------NNAVALSC--RSETATEWSWHK 182

  Fly   274 NGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHLFQTV 334
             |..|.::.........|..      |.|.::...|.|:|.|.|.|..|...|...|:.|:
 Worm   183 -GEQLLTNDGERYQMFPSGD------LIIRNISWSDMGEYNCTARNHFGETTAITFLYPTL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 5/16 (31%)
Ig 37..127 CDD:299845 59/256 (23%)
IG_like 154..234 CDD:214653 27/125 (22%)
IGc2 161..223 CDD:197706 21/107 (20%)
I-set 254..330 CDD:254352 19/75 (25%)
IGc2 254..322 CDD:197706 17/67 (25%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 25/106 (24%)
Ig 34..121 CDD:299845 23/93 (25%)
Ig <179..232 CDD:299845 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.