DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and zig-10

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:212 Identity:55/212 - (25%)
Similarity:81/212 - (38%) Gaps:44/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGH---LLAEPT 200
            ||..|.|  :..:..|...||..|....|.|..  :....::|.|:.:.:....||   :|.|..
 Worm    18 LSETIHT--LAPKKAPTERLVPIGSTTALECEP--YTSSNVTWYRDKHVIATVEGHKNAILNERK 78

  Fly   201 LR-------------IRSVHRMDRGGYYCIAQN----GEGQPDKRLIRVEVEFRPQIAVQRPKI- 247
            .|             |..|.:.|.|.|||..:|    ||      :.::::.:..:|: |..|| 
 Worm    79 PRGGEERIPEIGFLVIFDVQKEDEGNYYCQRENDSKWGE------VFQLKIAYVDEIS-QNEKIK 136

  Fly   248 ----AQMVSHSAELECSV-QGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGE 307
                ...:..|..|.|.: :.||.|.|.|..|.:|:.   |......|..:||    |.|.....
 Worm   137 LEPNVPTLGRSLVLHCPIPKAYPPPKVTWTVNSLPIS---HISSDYVAFPNGT----LIISHFSY 194

  Fly   308 EDFGDYYCNATNKLGHA 324
            ..||.:.||..|..|||
 Worm   195 HHFGYFECNINNFAGHA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 2/3 (67%)
Ig strand B 50..54 CDD:409353
Ig strand C 63..68 CDD:409353
Ig strand E 101..112 CDD:409353
Ig strand F 122..127 CDD:409353
Ig strand G 136..139 CDD:409353 55/212 (26%)
Ig_3 146..220 CDD:464046 20/89 (22%)
I-set 254..330 CDD:400151 24/72 (33%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 312..317 CDD:409353 1/4 (25%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 23/94 (24%)
Ig strand B 42..46 CDD:409353 1/3 (33%)
Ig strand C 53..57 CDD:409353 0/3 (0%)
Ig strand E 91..94 CDD:409353 0/2 (0%)
Ig strand F 104..109 CDD:409353 3/4 (75%)
Ig_3 134..206 CDD:464046 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.