DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and wrk-1

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001024651.1 Gene:wrk-1 / 181093 WormBaseID:WBGene00006942 Length:452 Species:Caenorhabditis elegans


Alignment Length:366 Identity:95/366 - (25%)
Similarity:154/366 - (42%) Gaps:71/366 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MARLRLLIGLIFCLAISLDSVLSAPVISQI---SKDVVASVGDSVEFNCTVEEVGQLSVSWAKRP 70
            |..:.|::||           |.|...:||   ...::|..|:|:...|.||: ..:::.|.|  
 Worm     2 MKLVLLILGL-----------LIASTSAQIRTKGGTLIAKEGESLTLRCEVED-PSVAIIWRK-- 52

  Fly    71 SESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVL---VSAT 132
                 |:.|:::.:.:......|.::: ||   .:::.|  |:.:|..:...|.|.:.   ||.|
 Worm    53 -----NTEVVAVDDEILDTYGGYEISM-EG---STSVLT--IKRVEPINSANYSCALAEPEVSVT 106

  Fly   133 ----EKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHA-NGFPKPTISWA---------- 182
                .:|.|...:.:|...||:.:|.........:||.:|||. .|.|||.:.|.          
 Worm   107 FVIKVQVFKPTQVSVKPLVVISPDTGVYHARVGEKNLVITCHVKEGNPKPGVVWTKQAAKLPEDI 171

  Fly   183 -REHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEV--------EFRP 238
             |||      ||..:.     |..|.:...|.|.|:|:|..|. |:..|.:.|        |.:|
 Worm   172 KREH------GGARIV-----ITEVKKHHAGKYNCLAENIAGS-DRATIDIHVAEPLQGEREEKP 224

  Fly   239 QIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNG--VPLQSSRHHEVANTASS-SGTTTSVL 300
            .:..:...|....:.:|...|:..|.|.|.|.|..||  :.....:..:.:.||.. :|.:.|.|
 Worm   225 WVKNEDTFIPVRKNQNASFWCTYDGTPVPQVEWLFNGYKINFNDEKFKKTSETAQRLNGYSKSTL 289

  Fly   301 RIDSVGEEDFGDYYCNATNKLGHADARLHLFQTVIPVPSLS 341
            .:..:.||.||||.|..:||||...|.:|:.....| |.||
 Worm   290 TVGDISEEAFGDYACRISNKLGSVTAVVHVSGRPGP-PQLS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 25/119 (21%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 1/4 (25%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 1/2 (50%)
Ig_3 146..220 CDD:464046 24/85 (28%)
I-set 254..330 CDD:400151 26/78 (33%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 298..302 CDD:409353 2/3 (67%)
Ig strand F 312..317 CDD:409353 3/4 (75%)
wrk-1NP_001024651.1 IG_like 25..113 CDD:214653 21/101 (21%)
Ig strand B 35..39 CDD:409353 0/3 (0%)
Ig strand C 47..51 CDD:409353 0/3 (0%)
Ig strand E 77..83 CDD:409353 1/7 (14%)
Ig strand F 93..98 CDD:409353 2/4 (50%)
Ig strand G 104..107 CDD:409353 1/2 (50%)
Ig 136..212 CDD:472250 25/87 (29%)
Ig strand B 143..147 CDD:409353 1/3 (33%)
Ig strand C 157..161 CDD:409353 0/3 (0%)
Ig strand E 178..182 CDD:409353 0/8 (0%)
Ig strand F 192..197 CDD:409353 2/4 (50%)
Ig 235..319 CDD:472250 26/83 (31%)
Ig strand C 254..258 CDD:409353 1/3 (33%)
Ig strand E 278..291 CDD:409353 4/12 (33%)
Ig strand F 301..306 CDD:409353 3/4 (75%)
Ig strand G 314..317 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.