DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and zig-4

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:232 Identity:52/232 - (22%)
Similarity:83/232 - (35%) Gaps:51/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 TEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISW---------AREHN- 186
            |..:|....::|..|       .:|.|:..|:..:|.|.....|..||.|         :.|.| 
 Worm    37 TNYLTSPAKIKIVAP-------LESALIPGGETYQLRCDIMSTPAATIHWKFNGKLIQGSNELNV 94

  Fly   187 ---------AVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVE------- 235
                     |::..|   :....|.|:.....:.|.|.|:..||. |..:.:..||:|       
 Worm    95 EEKLLNFGKAIVDTG---IVASILTIQCPSAENSGTYSCVGYNGH-QTIETVAEVEIEGEASGCR 155

  Fly   236 ----FRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTT 296
                ..|:|........:|..:.|.|.|  :.......||..|...::::...    |..|:|. 
 Worm   156 SNHKSAPEIVFWTDSRFEMTGNVATLVC--RANQQVDWVWMSNDELVKNNDKF----TVLSNGD- 213

  Fly   297 TSVLRIDSVGEEDFGDYYCNATNKLGHADARLHLFQT 333
               |.|.::..:|.|.|.|.|.|:.|.|.....|:.|
 Worm   214 ---LVIKNIVWDDMGTYTCIARNQFGEARQETFLYPT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 2/10 (20%)
Ig 37..127 CDD:299845
IG_like 154..234 CDD:214653 22/98 (22%)
IGc2 161..223 CDD:197706 18/80 (23%)
I-set 254..330 CDD:254352 19/75 (25%)
IGc2 254..322 CDD:197706 17/67 (25%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 24/110 (22%)
Ig 65..144 CDD:143165 18/82 (22%)
IG_like 176..245 CDD:214653 19/78 (24%)
Ig <193..238 CDD:299845 14/52 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.