DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and zig-8

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:248 Identity:50/248 - (20%)
Similarity:91/248 - (36%) Gaps:54/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEG 100
            ||...:|||.  :....:|:|....:..::|.:     .::..:|:..|.....|.|:.|:    
 Worm    41 SQTIVNVVAE--NPAYLHCSVPPDAEHEIAWTR-----VSDGALLTAGNRTFTRDPRWQVS---- 94

  Fly   101 PKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENT--PKSTLV---T 160
             |..:.|:...::..|..|.|.|.|:  ::........:.|::..||:.:.::  .|||.:   .
 Worm    95 -KKSANIWVLNLRRAEQQDSGCYLCE--INDKHNTVYAVYLKVLEPPLPSPSSLQKKSTKLMANM 156

  Fly   161 EGQNLELTCHANGFPKP----TISWAREHNAV-------------MPAGGHLLAEPTLRIRSVHR 208
            .|..:.|.|......|.    .:.|.|:.|.:             ..||   :...|:|||....
 Worm   157 SGDEVVLNCTVTSTDKDEEVLDVVWTRDGNTINFNDTEKYILKVKRDAG---VVIETMRIRKATM 218

  Fly   209 MDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSV 261
            .|.|.|.|   ....|...:::.:.            |.....|:||...||:
 Worm   219 EDDGNYAC---EHSQQKASQIVHIN------------KAEAQTSNSATFPCSI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 21/106 (20%)
Ig 37..127 CDD:299845 19/89 (21%)
IG_like 154..234 CDD:214653 21/99 (21%)
IGc2 161..223 CDD:197706 17/78 (22%)
I-set 254..330 CDD:254352 4/8 (50%)
IGc2 254..322 CDD:197706 4/8 (50%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 16/90 (18%)
Ig 55..129 CDD:143165 15/85 (18%)
ig 158..229 CDD:278476 17/76 (22%)
IG_like 158..227 CDD:214653 17/74 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.