DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and rig-5

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:330 Identity:98/330 - (29%)
Similarity:153/330 - (46%) Gaps:28/330 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLIG--LIFCLAISLDSVLSAPVISQIS-KDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDT 75
            ||.|  |:|..|.|..   :.|.|.|.| ...||.:|..|:|.|.|.::|...|::.|    :|:
 Worm    66 LLCGVLLVFKQACSRG---APPTIQQPSMSSAVALLGQDVDFTCIVNDLGSHMVAFVK----ADS 123

  Fly    76 NSVVLSMRNILSLPDQRYNVTVTEGPKTGSA--IYTFRIQNIEVSDMGPYECQVLVSATEKVTKK 138
            ...:||....:.....:|.:.    |:.|..  .:...|:|::.||.|.|.||:   .||.:|..
 Worm   124 PPRLLSFDEKVFRRRNKYELK----PRIGDLHNEWVLTIKNVQESDRGNYSCQI---NTEPITLS 181

  Fly   139 L-SLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWARE------HNAVMPAGGHLL 196
            . .|.:|.|||::.:||.:..|.||.|:.|||.|:|.|.||:.|.|:      :|.....|..:.
 Worm   182 TGELDVKVPPVVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVF 246

  Fly   197 AEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSV 261
            ..|.|.:..|.|.....|.|:|.||....:...:::.|.|.|.:..|...:...|...|.:.|:.
 Worm   247 HGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVTFPPLVQAQSETVQASVGSMARMVCTT 311

  Fly   262 QGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLG--HA 324
            :.:|.|.:.|.|:|.|:..|.:..:.:|.|....:..:|.|.:|....||.|.|.|.|..|  |:
 Worm   312 EAWPRPEMGWEKDGEPVYESNNVAMTHTVSGQYHSVHILEIRNVQSSHFGVYRCVAKNDNGIHHS 376

  Fly   325 DARLH 329
            ...|:
 Worm   377 QVTLN 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 32/113 (28%)
Ig 37..127 CDD:299845 25/92 (27%)
IG_like 154..234 CDD:214653 26/85 (31%)
IGc2 161..223 CDD:197706 24/67 (36%)
I-set 254..330 CDD:254352 23/78 (29%)
IGc2 254..322 CDD:197706 20/67 (30%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 28/107 (26%)
Ig_3 191..270 CDD:372822 27/78 (35%)
IG 294..380 CDD:214652 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3058
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.