DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and Kirrel

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus


Alignment Length:339 Identity:80/339 - (23%)
Similarity:134/339 - (39%) Gaps:65/339 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AISLDSVLSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMR---- 83
            :|.|| |...|.::...:......|:.|.|.|                 ::..|..:|..|    
Mouse   246 SIELD-VHHPPTVTLSIEPQTVLEGERVIFTC-----------------QATANPEILGYRWAKG 292

  Fly    84 --NILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVL--VSATEKVTKKLSLQIK 144
              .|....:.||...|.         |:|..:        |..|:|.  |.:| .|:..:::.. 
Mouse   293 GFLIEDAHESRYETNVD---------YSFFTE--------PVSCEVYNKVGST-NVSTLVNVHF- 338

  Fly   145 TPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAV------MPAGGHLLAE----- 198
            .|.::.  .||.|....|.::.|||...|.|..|::|.::.:.:      .|...:|.|:     
Mouse   339 APRIVV--YPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRLPGSPPEANLSAQVLSNS 401

  Fly   199 PTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQG 263
            ..|.::||.:.|.|.|.|.|........:|.:.:.|...|.|:.:..:.| :.....::||.:..
Mouse   402 NQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFA-VRGDGGKVECFIGS 465

  Fly   264 YPAPTVV---WHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYY-CNATNKLGHA 324
            .|.|..:   |.:|.:.:.:...:.|..|.|.|| ..|.|.|::|.|.||..:| |.|.|..|..
Mouse   466 TPPPDRIAWAWKENFLEVGTLERYTVERTNSGSG-VLSTLTINNVMEADFQTHYNCTAWNSFGPG 529

  Fly   325 DARLHLFQ-TVIPV 337
            .|.:.|.: .|:||
Mouse   530 TAIIQLEEREVLPV 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 20/117 (17%)
Ig 37..127 CDD:299845 15/95 (16%)
IG_like 154..234 CDD:214653 23/90 (26%)
IGc2 161..223 CDD:197706 19/72 (26%)
I-set 254..330 CDD:254352 24/79 (30%)
IGc2 254..322 CDD:197706 22/71 (31%)
KirrelXP_011238330.1 Ig 54..148 CDD:386229
Ig2_KIRREL3-like 170..251 CDD:143236 3/5 (60%)
Ig 255..336 CDD:386229 20/115 (17%)
Ig_3 340..421 CDD:372822 22/82 (27%)
Ig5_KIRREL3 439..536 CDD:143306 27/98 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.