DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and IGSF5

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_047296655.1 Gene:IGSF5 / 150084 HGNCID:5952 Length:497 Species:Homo sapiens


Alignment Length:298 Identity:69/298 - (23%)
Similarity:115/298 - (38%) Gaps:73/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DSVLSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSL--- 88
            :.|:..|..:::.|      |....|||||.: |...:.||.      ::.||||:|.:..:   
Human   129 NEVIEGPQNARVLK------GSQARFNCTVSQ-GWKLIMWAL------SDMVVLSVRPMEPIITN 180

  Fly    89 ---PDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVS---ATEKVTKKLSLQIKTPP 147
               ..|||:       :.|:......|.|:|.||.|...|.:..|   .:..:|.::..::..|.
Human   181 DRFTSQRYD-------QGGNFTSEMIIHNVEPSDSGNIRCSLQNSRLHGSAYLTVQVMGELFIPS 238

  Fly   148 ---VIAENTPKSTLVTEGQNLELTCHANGFPK-PTISWAR----EHNAVMPAGGHLLAEPT---- 200
               |:|||.|          .|:||..:.:.: |.|||..    .|::.     :.:.||:    
Human   239 VNLVVAENEP----------CEVTCLPSHWTRLPDISWELGLLVSHSSY-----YFVPEPSDLQS 288

  Fly   201 -LRIRSVHRMDRGGYYCIAQNGEGQPDK-RLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQG 263
             :.|.::.....|...|:|.....:..| ..:.:.|...||.......|..::|....|     |
Human   289 AVSILALTPQSNGTLTCVATWKSLKARKSATVNLTVIRCPQDTGGGINIPGVLSSLPSL-----G 348

  Fly   264 YPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVLR 301
            :..||  |.|.|:.|        |.|...:.|.|..:|
Human   349 FSLPT--WGKVGLGL--------AGTMLLTPTCTLTIR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 29/118 (25%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..68 CDD:409353 1/4 (25%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 1/4 (25%)
Ig strand G 136..139 CDD:409353 1/2 (50%)
Ig_3 146..220 CDD:464046 20/86 (23%)
I-set 254..330 CDD:400151 13/48 (27%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 298..302 CDD:409353 1/4 (25%)
Ig strand F 312..317 CDD:409353
IGSF5XP_047296655.1 IG_like 135..228 CDD:214653 28/112 (25%)
Ig_3 233..308 CDD:464046 19/89 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.