DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and Opcml

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:301 Identity:84/301 - (27%)
Similarity:128/301 - (42%) Gaps:40/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGS 105
            :|....|:|....||::: ....|:|..|       |.:|...|.....|.|..:.|....:   
  Rat    44 NVTVRQGESATLRCTIDD-RVTRVAWLNR-------STILYAGNDKWSIDPRVIILVNTPTQ--- 97

  Fly   106 AIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCH 170
              |:..|||::|.|.|||.|.|......| |.::.|.::.||.|. |......|.||.::.|.|.
  Rat    98 --YSIMIQNVDVYDEGPYTCSVQTDNHPK-TSRVHLIVQVPPQIM-NISSDITVNEGSSVTLLCL 158

  Fly   171 ANGFPKPTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVE 235
            |.|.|:||::|  .|.:|....|.:..:..|.|..:.|...|.|.|.|.|....||.|.:::.|.
  Rat   159 AIGRPEPTVTW--RHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVN 221

  Fly   236 FRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHK---------NGVPLQSSRHHEVANTAS 291
            :.|.|: :.......|.....|.|.....|.....|.|         :||.:::...        
  Rat   222 YPPYIS-KAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGR-------- 277

  Fly   292 SSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHLFQ 332
                 .|.|...:|.|:|:|:|.|.||||||:.:|.:.|::
  Rat   278 -----ISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 28/101 (28%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 2/4 (50%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 1/2 (50%)
Ig_3 146..220 CDD:464046 25/73 (34%)
I-set 254..330 CDD:400151 22/84 (26%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 2/3 (67%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
OpcmlXP_017450901.1 Ig 44..132 CDD:472250 28/101 (28%)
Ig strand B 53..57 CDD:409353 0/3 (0%)
Ig strand C 65..69 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 3/4 (75%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 135..206 CDD:464046 25/73 (34%)
Ig 224..312 CDD:472250 25/101 (25%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.