DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and lrit3

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002934296.2 Gene:lrit3 / 100494489 XenbaseID:XB-GENE-6076513 Length:652 Species:Xenopus tropicalis


Alignment Length:111 Identity:31/111 - (27%)
Similarity:51/111 - (45%) Gaps:11/111 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 RVEVE----FRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANTAS 291
            |||:|    .:|.:.....||...:..:..|.|...|.|.|.::|.:..   .|:.::.|.....
 Frog   245 RVELEQEMCLKPSVMTSATKITSPLGSNVLLRCDASGNPTPQLLWSRTN---NSAANYTVVQETP 306

  Fly   292 SSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHLFQTVIPV 337
            :.|...|:|.::.:..:|.|:|.|.|.|..|.|:|.:    |||.|
 Frog   307 TDGVRWSILSMNGISYKDAGEYRCKAKNFAGVAEASI----TVIVV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151
Ig strand B 50..54 CDD:409353
Ig strand C 63..68 CDD:409353
Ig strand E 101..112 CDD:409353
Ig strand F 122..127 CDD:409353
Ig strand G 136..139 CDD:409353
Ig_3 146..220 CDD:464046
I-set 254..330 CDD:400151 20/75 (27%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 2/3 (67%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
lrit3XP_002934296.2 leucine-rich repeat 59..82 CDD:275378
LRR <61..>172 CDD:443914
leucine-rich repeat 83..106 CDD:275378
leucine-rich repeat 107..130 CDD:275378
leucine-rich repeat 131..154 CDD:275378
leucine-rich repeat 155..168 CDD:275378
Ig_3 255..334 CDD:464046 19/81 (23%)
FN3 455..518 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.