DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and ntm

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:294 Identity:92/294 - (31%)
Similarity:133/294 - (45%) Gaps:27/294 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGS 105
            :|....|||....|||:. ....|:|..|       |.:|...|.....|.|  |.:....|:. 
 Frog    45 NVTVRQGDSAILRCTVDN-RVTRVAWLNR-------STILYTGNDKWSIDPR--VVLLANTKSQ- 98

  Fly   106 AIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCH 170
              |:..|||:::.|.|||.|.|......| |.::.|.::.||.|.: ...|..|.||.|:.|.|.
 Frog    99 --YSIEIQNVDIYDEGPYTCSVQTDNHPK-TSRVHLIVQVPPRIVD-ISSSIAVNEGSNVSLICI 159

  Fly   171 ANGFPKPTISWAREHNAVMP-AGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEV 234
            |||.|:|.::|    ..:.| |.|.:..:..|.|..:.|...|.|.|.|.|....||.|.:::.|
 Frog   160 ANGRPEPVVNW----RYLSPKARGFVSEDEYLEITGITREQSGIYECSASNDVSAPDVRRVKLTV 220

  Fly   235 EFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSS-RHHEVANTASSSGTTTS 298
            .:.|.| :....|...:.|...|:|.....||....|:|....|..| |..:|.|..:.|..|  
 Frog   221 NYPPYI-LDAQNIGAPLGHRGILQCEASAVPAADFFWYKEDKRLSDSWRGVKVENRETISRVT-- 282

  Fly   299 VLRIDSVGEEDFGDYYCNATNKLGHADARLHLFQ 332
               ..:|.|:|:|:|.|.|.|.|||::|.:.||:
 Frog   283 ---FLNVSEQDYGNYTCMAKNLLGHSNASIILFE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 30/101 (30%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 2/4 (50%)
Ig strand E 101..112 CDD:409353 2/10 (20%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 1/2 (50%)
Ig_3 146..220 CDD:464046 26/74 (35%)
I-set 254..330 CDD:400151 25/76 (33%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 0/3 (0%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
ntmXP_004916061.1 Ig 45..133 CDD:472250 30/101 (30%)
Ig strand B 54..58 CDD:409353 0/3 (0%)
Ig strand C 66..70 CDD:409353 1/3 (33%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 3/4 (75%)
Ig strand G 126..129 CDD:409353 1/2 (50%)
Ig_3 136..206 CDD:464046 26/74 (35%)
ig 227..311 CDD:395002 27/88 (31%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/8 (25%)
Ig strand F 293..298 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.