DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and adgrl1.1

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002660669.2 Gene:adgrl1.1 / 100334775 ZFINID:ZDB-GENE-130116-2 Length:390 Species:Danio rerio


Alignment Length:279 Identity:55/279 - (19%)
Similarity:85/279 - (30%) Gaps:106/279 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KRPSESDTNSVVL----------SMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGP 122
            |.||..|....|:          ..|||:.. |.|..:      |:|.|:    |.|....|..|
Zfish   136 KLPSRVDGTGFVVYDGAVFYNKERTRNIVKY-DLRTRI------KSGEAV----IVNANYHDASP 189

  Fly   123 Y--------ECQV------LVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANG 173
            |        :..|      ::..||....:|        |:::..| .||..||           
Zfish   190 YHRGGKSDIDLAVDEHGLWVIYTTEANNGRL--------VVSQVNP-YTLRFEG----------- 234

  Fly   174 FPKPTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMD---RGG---------------------- 213
                  :|.......|.:...:.......:|||::.|   .||                      
Zfish   235 ------TWQTSFEKRMASDAFVACGILYAVRSVYQDDDSEAGGDLILYAYDTRRNREEPVRIPFP 293

  Fly   214 --YYCIAQNGEGQPDKRL--------IRVEVEFRPQIAVQRPKIAQMVSHS--AELECSV-QGY- 264
              |..|:.......|.:|        :|..:||.|......|....::|.:  :.|..:| .|: 
Zfish   294 NPYQHISSISYNPRDNQLYVWNNYIVLRYPLEFSP
PQPTTDPLSTPLLSTTPPSSLSSTVSMGFS 358

  Fly   265 --PAPTVVWH----KNGVP 277
              ..|:|.:|    ||..|
Zfish   359 PTSVPSVTFHPVGAKNRAP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 22/98 (22%)
Ig 37..127 CDD:299845 18/76 (24%)
IG_like 154..234 CDD:214653 18/114 (16%)
IGc2 161..223 CDD:197706 12/88 (14%)
I-set 254..330 CDD:254352 9/34 (26%)
IGc2 254..322 CDD:197706 9/34 (26%)
adgrl1.1XP_002660669.2 OLF 72..328 CDD:295358 43/228 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.