DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ama and lrit3b

DIOPT Version :9

Sequence 1:	NP_731114.2	Gene:	Ama / 40831	FlyBaseID:	FBgn0000071	Length:	341	Species:	Drosophila melanogaster
Sequence 2:	XP_009305418.1	Gene:	lrit3b / 100144406	ZFINID:	ZDB-GENE-070424-130	Length:	487	Species:	Danio rerio

Alignment Length:	112	Identity:	27/112 - (24%)
Similarity:	44/112 - (39%)	Gaps:	18/112 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   237 RPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNG----------VPLQSSRHHE------ 285
            ||.:.....||..::..:..|.|...|:|.|.::|.|:.          ...|||...|
Zfish   278 RPYVVTSATKITALLGSTVLLRCEATGHPTPALMWIKSAKRNLYNQGCCKQTQSSLDTERFPKKL 342

  Fly   286 --VANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHL 330
              ....:...|...||:.::.:...|.|:|.|.|.|..|.::|.:.|
Zfish   343 FGYVQESPRVGVRWSVVSLNGISYSDAGEYRCRAQNMAGISEAVVSL 389

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ama	NP_731114.2	I-set	33..143	CDD:254352
		Ig	37..127	CDD:299845
		IG_like	154..234	CDD:214653
		IGc2	161..223	CDD:197706
		I-set	254..330	CDD:254352	22/93 (24%)
		IGc2	254..322	CDD:197706	20/85 (24%)
lrit3b	XP_009305418.1	LRRNT	51..92	CDD:214470
		leucine-rich repeat	69..89	CDD:275380
		LRR_8	112..172	CDD:290566
		leucine-rich repeat	114..137	CDD:275378
		leucine-rich repeat	138..161	CDD:275378
		LRR_8	160..214	CDD:290566
		LRR_4	160..201	CDD:289563
		leucine-rich repeat	162..185	CDD:275378
		leucine-rich repeat	186..199	CDD:275378
		leucine-rich repeat	215..230	CDD:275378
		Ig	278..391	CDD:299845	27/112 (24%)
		I-set	279..391	CDD:254352	26/111 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900