DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and HB16

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 / 830169 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana


Alignment Length:216 Identity:52/216 - (24%)
Similarity:82/216 - (37%) Gaps:46/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHK 160
            :.||.:.    .|:..||::|.....|...|...|:.:|.|...||.:||:|||.|.|.: ...|
plant    59 KKRRLKV----DQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTK-QLEK 118

  Fly   161 DQ-----SYEGMPLSPGMKQSDGDPPSLQTLS-----LGGGATPN---ALT----------PSPT 202
            |.     .|:.:..:....:.|.| ..||.:|     :.|....|   |:|          ....
plant   119 DYGVLKGQYDSLRHNFDSLRRDND-SLLQEISKIKAKVNGEEDNNNNKAITEGVKEEEVHKTDSI 182

  Fly   203 PSTPTAHMTEH-----YSESF--------NAYYNYNGGHNHAQANRHMHMQYPSGGGPGPGSTNV 254
            ||:|...: ||     |..||        |:.....|..:...::..::.:..|..|.......|
plant   183 PSSPLQFL-EHSSGFNYRRSFTDLRDLLPNSTVVEAGSSDSCDSSAVLNDETSSDNGRLTPPVTV 246

  Fly   255 NGG---QFFQQQQVHNHQQQL 272
            .||   ||.:.:|..:|:..|
plant   247 TGGSFLQFVKTEQTEDHEDFL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 17/46 (37%)
HB16NP_195716.1 Homeobox 59..112 CDD:395001 19/56 (34%)
HALZ 114..155 CDD:396657 8/42 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.