DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Mnx1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001258203.1 Gene:Mnx1 / 682076 RGDID:1588091 Length:403 Species:Rattus norvegicus


Alignment Length:312 Identity:77/312 - (24%)
Similarity:107/312 - (34%) Gaps:106/312 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PHTHTHP----------------------HP---------------HSHP-HPHS---------- 32
            ||.|.||                      ||               :.|| :.:|          
  Rat   113 PHHHAHPGAAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHPVYSYSAAAAAAALAG 177

  Fly    33 -HPHPHHQHPQLQ--LPPQFRNPFDL-----LFDERTGAINYNYIRPYLPNQMPKPDVFPSEELP 89
             ||...:.:||:|  .|....:|..|     ..|:...|.....|.|.:|:       |.|:  .
  Rat   178 QHPALSYSYPQVQGAHPAHPADPIKLGAGTFQLDQWLRASTAGMILPKMPD-------FSSQ--A 233

  Fly    90 DSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKI 154
            .|.::.:.||.||.|||.|:.|||..|...:||:.|:..:::..|.|...||||||:|||.:.| 
  Rat   234 QSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWK- 297

  Fly   155 QSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGA--------TPNALTPSPT--------- 202
            :|.:.|:|:.:......|.               ||||        |...|...|.         
  Rat   298 RSKKAKEQAAQEAEKQKGS---------------GGGAGKGGTEEKTEEELLGPPVSGDKASGRR 347

  Fly   203 -----PSTPTAHMTEHYSESFNAYYNYNGGH-NHAQANRHMHMQYPSGGGPG 248
                 .|.|..  .|...|....|.|..|.| ..:..:.......|..||||
  Rat   348 LRDLRDSDPDE--DEDDEEDHFPYSNGVGAHAASSDCSSEDDSPPPRPGGPG 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)
Mnx1NP_001258203.1 Homeobox 244..297 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.