Sequence 1: | NP_788587.1 | Gene: | bcd / 40830 | FlyBaseID: | FBgn0000166 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038589.1 | Gene: | meox2b / 566969 | ZFINID: | ZDB-GENE-060503-853 | Length: | 289 | Species: | Danio rerio |
Alignment Length: | 262 | Identity: | 67/262 - (25%) |
---|---|---|---|
Similarity: | 97/262 - (37%) | Gaps: | 70/262 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 HTHTHPHPHSHPHPHSHPHPHHQH-PQ----------LQLP------PQF------------RNP 52
Fly 53 FDLLFDERTGAI---------NYNYIRPYLPNQMPKPDVFPSEE-LPDSLVMRRPRRTRTTFTSS 107
Fly 108 QIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPG 172
Fly 173 MKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQANRHM 237
Fly 238 HM 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bcd | NP_788587.1 | Homeobox | 106..153 | CDD:278475 | 20/46 (43%) |
meox2b | NP_001038589.1 | Homeobox | 177..229 | CDD:278475 | 24/51 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |