DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and hoxa1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001008017.1 Gene:hoxa1 / 493379 XenbaseID:XB-GENE-480737 Length:323 Species:Xenopus tropicalis


Alignment Length:236 Identity:65/236 - (27%)
Similarity:92/236 - (38%) Gaps:59/236 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QNFYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNYIRPY 72
            |:.|...:..:....|.|......|..:.||.:          .|     |:.....|||.....
 Frog   120 QSVYSGNIASSVVQHHQHQSYIEGSAHYIHHSY----------GP-----DQNISVANYNNNVSS 169

  Fly    73 L----------PNQMPKPDVFPSEELPDSLVMRRPRRT---------------RTTFTSSQIAEL 112
            |          |:....|.  |::......|.|.|.:|               ||.||:.|:.||
 Frog   170 LHISQREVCRSPSSETSPG--PAQTFDWMKVKRNPPKTGKAGEYGFAGQPNTARTNFTTKQLTEL 232

  Fly   113 EQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEG-MPLSPGMKQS 176
            |:.|...:|||..|..:::|.|.|...||||||:|||.:       .|.:..|| :|:||  ..|
 Frog   233 EKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMK-------QKKREKEGLLPISP--SAS 288

  Fly   177 DGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHMTEHYSES 217
            .|.....:.||....::|.|  |||..||     ::|.|.|
 Frog   289 TGSDEKSEELSEKSNSSPCA--PSPASST-----SDHLSTS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 21/46 (46%)
hoxa1NP_001008017.1 Homeobox 221..274 CDD:365835 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.