DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and NOS1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001191147.1 Gene:NOS1 / 4842 HGNCID:7872 Length:1468 Species:Homo sapiens


Alignment Length:186 Identity:42/186 - (22%)
Similarity:58/186 - (31%) Gaps:75/186 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 QASACRVLVKDEPEADYNFNSSYYMRSGMSGATASASAVARGAASPGSEVYEPLTPKNDESPSLC 368
            ||....:.|...|..|.:::              ||..|.||.|   ||.:..|..:..|     
Human    59 QAGDIILAVNGRPLVDLSYD--------------SALEVLRGIA---SETHVVLILRGPE----- 101

  Fly   369 GIGIGGPCAIAVGETEAADD--MDDGTSKKTTLQILEPL----KGLDKSCDDGSSDDMSTGIRAL 427
                        |.|...:.  ..|||.|  |:::.:||    |.:|.|                
Human   102 ------------GFTTHLETTFTGDGTPK--TIRVTQPLGPPTKAVDLS---------------- 136

  Fly   428 AGTGNRGAAFAKFGKPSPPQGPQPPLGMGGVAMGESNQYQCTMDTIMQAYN-PHRN 482
                           ..||.|.:.||.:.| |.|..|..|...|...:|.: ||.|
Human   137 ---------------HQPPAGKEQPLAVDG-ASGPGNGPQHAYDDGQEAGSLPHAN 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475
NOS1NP_001191147.1 PDZ_signaling 15..98 CDD:238492 14/55 (25%)
NOS_oxygenase_euk 305..716 CDD:238410
CysJ 759..1433 CDD:223446
Flavodoxin_1 762..969 CDD:278677
Nitric_oxide_synthase 1035..1438 CDD:99799
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.75 Normalized mean entropy S1636
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.