DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Abd-B

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster


Alignment Length:322 Identity:56/322 - (17%)
Similarity:88/322 - (27%) Gaps:153/322 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HSHPHPHSHPHPHHQHPQLQL-------------------------------------------- 45
            :...|..::|:|..|.|..|.                                            
  Fly   273 YDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYE 337

  Fly    46 PPQFRNPFDL--------LFDERTGAINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRT 102
            ||.:.:|..|        .....:|.::...:.|..||    |.:   .|....:.:|:.|:..:
  Fly   338 PPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPN----PGL---HEWTGQVSVRKKRKPYS 395

  Fly   103 TFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGM 167
            .|   |..|||:.||...|::..:..:|:..|.|...||||||:|||.::|..|.:..:|.    
  Fly   396 KF---QTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQ---- 453

  Fly   168 PLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQ 232
                                                               |...|.:..|||||
  Fly   454 ---------------------------------------------------NNNNNSSSNHNHAQ 467

  Fly   233 ANRHMHMQYPSGGGPGPGSTNVNGGQFFQQQQVHNHQQQLHHQGNHVPHQMQQQQQQAQQQQ 294
            |.                                    |.||.|:|:...:......|:..|
  Fly   468 AT------------------------------------QQHHSGHHLNLSLNMGHHAAKMHQ 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 19/46 (41%)
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439753
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.