Sequence 1: | NP_788587.1 | Gene: | bcd / 40830 | FlyBaseID: | FBgn0000166 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002450.2 | Gene: | meox1 / 436723 | ZFINID: | ZDB-GENE-040718-149 | Length: | 253 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 52/207 - (25%) |
---|---|---|---|
Similarity: | 79/207 - (38%) | Gaps: | 49/207 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 PHPHSHPHP---HSHPHPHHQHPQLQLPP-----QFRNP-----------FDLLFDER-TGAINY 66
Fly 67 NYIRPYLPNQMPKPDVFPSE--------ELPDSLVMR----RPRRTRTTFTSSQIAELEQHFLQG 119
Fly 120 RYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQ 184
Fly 185 TLSLGGGATPNA 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bcd | NP_788587.1 | Homeobox | 106..153 | CDD:278475 | 19/46 (41%) |
meox1 | NP_001002450.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 136..158 | 2/21 (10%) | |
Homeobox | 174..226 | CDD:278475 | 23/51 (45%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 226..253 | 9/44 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |