DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Antp

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:227 Identity:62/227 - (27%)
Similarity:84/227 - (37%) Gaps:80/227 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PP--DQNFYHH-----PLPHTHTHP-----------------HPHSH-----------------P 28
            ||  ||...||     .|||...||                 |.:.|                 |
  Fly   180 PPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPP 244

  Fly    29 HPHSH-----PHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNYIRPYLPNQMPKPDVFPSEEL 88
            ....|     |..|..||....||. :||    ..:.:|..:..|  |::.:|..|         
  Fly   245 QGMMHQGQGPPQMHQGHPGQHTPPS-QNP----NSQSSGMPSPLY--PWMRSQFGK--------- 293

  Fly    89 PDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHK 153
                 .:..:|.|.|:|..|..|||:.|...||||..|..:::..|.|...|:||||:|||.:.|
  Fly   294 -----CQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 353

  Fly   154 IQSDQHKDQSYEGMPLSPGMKQSDGD---PPS 182
                  |:...:|.|.|.|    :||   ||:
  Fly   354 ------KENKTKGEPGSGG----EGDEITPPN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 31/146 (21%)
Homeobox 301..354 CDD:395001 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.