DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and ftz

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:237 Identity:67/237 - (28%)
Similarity:96/237 - (40%) Gaps:66/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GAINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPR 126
            |..|:::|...|           :.:..||      :|||.|:|..|..|||:.|...||:|..|
  Fly   236 GDFNWSHIEETL-----------ASDCKDS------KRTRQTYTRYQTLELEKEFHFNRYITRRR 283

  Fly   127 LADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGG 191
            ..|::..|:|...|:||||:|||.:.|      ||::.:..|...|...:...|| |:       
  Fly   284 RIDIANALSLSERQIKIWFQNRRMKSK------KDRTLDSSPEHCGAGYTAMLPP-LE------- 334

  Fly   192 ATPNALTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQANRHMHMQYPSGGGPGPGSTNVNG 256
            ||..|.|.:|:...|    ..|:.::..||..|:..|:|...   :...||              
  Fly   335 ATSTATTGAPSVPVP----MYHHHQTTAAYPAYSHSHSHGYG---LLNDYP-------------- 378

  Fly   257 GQFFQQQQVHNHQQQLHHQGNHVPHQMQQQ--QQQAQQQQYH 296
                        |||.|.|.:..|.|.|.|  .||..|..||
  Fly   379 ------------QQQTHQQYDAYPQQYQHQCSYQQHPQDLYH 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 4/22 (18%)
Homeobox 257..310 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439771
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.