DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and lab

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster


Alignment Length:346 Identity:78/346 - (22%)
Similarity:104/346 - (30%) Gaps:161/346 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HHPLPHTH-----THPH------------PHSHP-HPHSH-PHPHHQHPQLQLPP---------- 47
            ||.|||.|     .:||            ||..| ||.:. |..|.||.|..:.|          
  Fly   290 HHGLPHGHLGNLANNPHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQHHQNSVSPNGGMNRQQRG 354

  Fly    48 ------------------------QFRNPFDLLFDERTGAINYNYIRPYLPNQMPKPDVFPSEEL 88
                                    |.::|     :..:....|.:::  |...:|||.   :.:|
  Fly   355 GVISPGSSTSSSTSASNGAHPASTQSKSP-----NHSSSIPTYKWMQ--LKRNVPKPQ---APKL 409

  Fly    89 P---------------------------------------------------DSLVMRRPRRT-- 100
            |                                                   :||:|......  
  Fly   410 PASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAG 474

  Fly   101 ------------------------------RTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLA 135
                                          ||.||:.|:.|||:.|...||||..|..:::..|.
  Fly   475 SAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQ 539

  Fly   136 LGTAQVKIWFKNRRRRHK-------IQSD---QHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGG 190
            |...||||||:|||.:.|       |.:|   ||........|    .:|....||.||..|.|.
  Fly   540 LNETQVKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKP----PQQQQPQPPELQLKSQGS 600

  Fly   191 GATPNALTPSPTPSTPTAHMT 211
            ....|.|. :..|||||..||
  Fly   601 DLGGNELA-TGAPSTPTTAMT 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 21/46 (46%)
labNP_476613.1 Homeobox 505..557 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439777
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.