DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and PDX1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_000200.1 Gene:PDX1 / 3651 HGNCID:6107 Length:283 Species:Homo sapiens


Alignment Length:229 Identity:60/229 - (26%)
Similarity:92/229 - (40%) Gaps:45/229 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PPDQNFYHHP-------LPHTHTH-PHPHSHPHPHSHPHPHHQHP-QLQLPPQFRNPFDLLFDER 60
            |||.:.|..|       :.|.|.| |...:.|||.:.|.|....| .|:.|.:.:.||..:...:
Human    62 PPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTK 126

  Fly    61 TGAINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAP 125
            ..|....:.......:       |.|.          :||||.:|.:|:.|||:.||..:|::.|
Human   127 AHAWKGQWAGGAYAAE-------PEEN----------KRTRTAYTRAQLLELEKEFLFNKYISRP 174

  Fly   126 RLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKD-------------------QSYEGMPLSP 171
            |..:|:..|.|....:||||:|||.:.|.:.|:.:.                   .|.|.:...|
Human   175 RRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALP 239

  Fly   172 GMKQSDGDPPSLQTLSLGGGATPNALTPSPTPST 205
            ......|..|....::...|..|..|:.||.||:
Human   240 PPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 19/46 (41%)
PDX1NP_000200.1 Transactivation domain. /evidence=ECO:0000250 13..73 5/10 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..71 4/8 (50%)
Antp-type hexapeptide 118..123 2/4 (50%)
Homeobox 149..202 CDD:278475 23/52 (44%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.