DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Meox1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:237 Identity:57/237 - (24%)
Similarity:74/237 - (31%) Gaps:95/237 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HPHSHPH-----PHSHPHPHHQHPQLQLP-----PQF------RNPFDLLFDERTGAINYNYIRP 71
            :|||...     ||..|.|...|.:...|     |.|      ..|..|...||.    :|...|
  Rat    24 NPHSEGSSASGLPHYPPTPFSFHQKSDFPATAAYPDFSTSCLAATPHSLPRAERI----FNEQHP 84

  Fly    72 YLPNQMPKPD-VFPSEEL------------------------------PDSLVM----------- 94
            ..|.   .|| .||..|.                              .|.:|:           
  Rat    85 AFPQ---TPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTGGLGEDCMVLGTIAHETEKKL 146

  Fly    95 ---------------------RRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGT 138
                                 .:.|:.||.||..|:.|||..|....|||..|..:::..|.|..
  Rat   147 SRRKKERSDNPENGGGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSE 211

  Fly   139 AQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQ-SDGD 179
            .|||:||:|||.:.|        :...|.|:||..:. .|||
  Rat   212 RQVKVWFQNRRMKWK--------RVKGGQPVSPQEQDPEDGD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 19/46 (41%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 32/115 (28%)
Homeobox 174..227 CDD:395001 24/60 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.