Sequence 1: | NP_788587.1 | Gene: | bcd / 40830 | FlyBaseID: | FBgn0000166 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102307.1 | Gene: | Meox1 / 363684 | RGDID: | 1308911 | Length: | 253 | Species: | Rattus norvegicus |
Alignment Length: | 237 | Identity: | 57/237 - (24%) |
---|---|---|---|
Similarity: | 74/237 - (31%) | Gaps: | 95/237 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 HPHSHPH-----PHSHPHPHHQHPQLQLP-----PQF------RNPFDLLFDERTGAINYNYIRP 71
Fly 72 YLPNQMPKPD-VFPSEEL------------------------------PDSLVM----------- 94
Fly 95 ---------------------RRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGT 138
Fly 139 AQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQ-SDGD 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bcd | NP_788587.1 | Homeobox | 106..153 | CDD:278475 | 19/46 (41%) |
Meox1 | NP_001102307.1 | COG5576 | 139..251 | CDD:227863 | 32/115 (28%) |
Homeobox | 174..227 | CDD:395001 | 24/60 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |