Sequence 1: | NP_788587.1 | Gene: | bcd / 40830 | FlyBaseID: | FBgn0000166 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055436.2 | Gene: | HOXD4 / 3233 | HGNCID: | 5138 | Length: | 255 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 59/203 - (29%) |
---|---|---|---|
Similarity: | 79/203 - (38%) | Gaps: | 42/203 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 QPPPDQNFYHHPLPHTHTHPHPHSHPHPHS------H------PHPHHQHPQLQLP-PQFRNPFD 54
Fly 55 LLFDERTGAINYNYIRPYLP---NQMPKPD-VFP------SEELPDSLVMRRPRRTRTTFTSSQI 109
Fly 110 AELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMK 174
Fly 175 QSDGDPPS 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bcd | NP_788587.1 | Homeobox | 106..153 | CDD:278475 | 20/46 (43%) |
HOXD4 | NP_055436.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 31..127 | 24/89 (27%) | |
Antp-type hexapeptide | 133..138 | 2/4 (50%) | |||
Homeobox | 157..210 | CDD:306543 | 23/52 (44%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 212..255 | 6/25 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |