Sequence 1: | NP_788587.1 | Gene: | bcd / 40830 | FlyBaseID: | FBgn0000166 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002136.1 | Gene: | HOXB2 / 3212 | HGNCID: | 5113 | Length: | 356 | Species: | Homo sapiens |
Alignment Length: | 249 | Identity: | 65/249 - (26%) |
---|---|---|---|
Similarity: | 87/249 - (34%) | Gaps: | 81/249 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 PPPDQNFYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNY 68
Fly 69 IRPYLPNQMPKPDVFP-------------SEELPDSLVMRRP---------------------RR 99
Fly 100 TRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSY 164
Fly 165 EGMPLSPGMKQSDGDPPSLQTLSLGGGA---------------TPNALTPSPTP 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bcd | NP_788587.1 | Homeobox | 106..153 | CDD:278475 | 20/46 (43%) |
HOXB2 | NP_002136.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 39..142 | 21/125 (17%) | |
Antp-type hexapeptide | 94..99 | 2/5 (40%) | |||
Homeobox | 147..199 | CDD:278475 | 23/51 (45%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 197..240 | 14/44 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |