DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and HOXB1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_002135.2 Gene:HOXB1 / 3211 HGNCID:5111 Length:301 Species:Homo sapiens


Alignment Length:223 Identity:60/223 - (26%)
Similarity:88/223 - (39%) Gaps:70/223 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HPHSH-------------------PHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNY 68
            ||.|:                   |:|..|| |:.........|.:.   |||.:::....    
Human   112 HPSSYGAQLGGLSDGYGAGGAGPGPYPPQHP-PYGNEQTASFAPAYA---DLLSEDKETPC---- 168

  Fly    69 IRPYLPNQMPKPDVFPSEELPDSL-VMRRPRRT--------------RTTFTSSQIAELEQHFLQ 118
              |..||.       |:....|.: |.|.|.:|              ||.||:.|:.|||:.|..
Human   169 --PSEPNT-------PTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHF 224

  Fly   119 GRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGM--PLSPGM-KQSDGDP 180
            .:||:..|..:::|.|.|...||||||:|||.:.|      |.:..||.  |..||. |::.||.
Human   225 NKYLSRARRVEIAATLELNETQVKIWFQNRRMKQK------KREREEGRVPPAPPGCPKEAAGDA 283

  Fly   181 PSLQTLSLGGGATPNALTPSPTPSTPTA 208
            ....|.:          :|..:||:.|:
Human   284 SDQSTCT----------SPEASPSSVTS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)
HOXB1NP_002135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..149 5/22 (23%)
Antp-type hexapeptide 179..184 1/4 (25%)
Homeobox 207..259 CDD:278475 24/51 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..301 16/62 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.