DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and HOXA4

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_002132.3 Gene:HOXA4 / 3201 HGNCID:5105 Length:320 Species:Homo sapiens


Alignment Length:294 Identity:73/294 - (24%)
Similarity:105/294 - (35%) Gaps:111/294 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QPPPDQNFYHHP-----LPH---------THTHPHPHSHP-HPHSHPHPHH-------------- 38
            |.||.....|.|     |||         ::..|.....| :|.:..:|.|              
Human    43 QQPPAPPTQHLPLQQPQLPHAGGGREPTASYYAPRTAREPAYPAAALYPAHGAADTAYPYGYRGG 107

  Fly    39 ----QHPQLQLPP-QFRNPFDLLFDERTGAINYNYIRPYLP------------------------ 74
                :.||.:.|| |.:.|       ..|....:.::|.||                        
Human   108 ASPGRPPQPEQPPAQAKGP-------AHGLHASHVLQPQLPPPLQPRAVPPAAPRRCEAAPATPG 165

  Fly    75 ---------------NQMP------KPDVFP-SEELPDSLVM-----RRPRRTRTTFTSSQIAEL 112
                           ::.|      :|.|:| .:::..|.|.     ..|:|:||.:|..|:.||
Human   166 VPAGGSAPACPLLLADKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLEL 230

  Fly   113 EQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRR----HKIQSDQHKDQSYEGMPLSPGM 173
            |:.|...||||..|..:::..|.|...||||||:|||.:    ||:.:.:        |..|...
Human   231 EKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTK--------MRSSNSA 287

  Fly   174 KQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPT 207
            ..|.|.|...||.|      |: |.|.|.|||.|
Human   288 SASAGPPGKAQTQS------PH-LHPHPHPSTST 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 21/50 (42%)
HOXA4NP_002132.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..77 8/33 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..168 10/73 (14%)
Antp-type hexapeptide 194..199 2/4 (50%)
Homeobox 218..271 CDD:278475 24/52 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..320 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.