DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and pdx1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_571518.2 Gene:pdx1 / 30721 ZFINID:ZDB-GENE-990415-122 Length:246 Species:Danio rerio


Alignment Length:189 Identity:54/189 - (28%)
Similarity:84/189 - (44%) Gaps:33/189 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNYIRPYLPN----------QMPKPDVFP 84
            ||.| .|......||....:.:..||..|..    .|:...|::.:          |...|.:..
Zfish    74 PHLH-LPQTSQTSLQSLGGYGDSLDLCGDRN----RYHLPFPWMKSTKSHTHAWKGQWTGPYMVE 133

  Fly    85 SEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRR 149
            :||         .:||||.:|.:|:.|||:.||..:|::.||..:|:..|:|....:||||:|||
Zfish   134 AEE---------NKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELALTLSLTERHIKIWFQNRR 189

  Fly   150 RRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTA 208
            .:.|.:.|:.:.:   |:........:.||   |:..|..|.||   |...|:|..|.|
Zfish   190 MKWKKEEDKRRAR---GVDPEQDSSITSGD---LKDESCVGTAT---LAGPPSPLHPHA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 19/46 (41%)
pdx1NP_571518.2 Homeobox 140..193 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.