Sequence 1: | NP_788587.1 | Gene: | bcd / 40830 | FlyBaseID: | FBgn0000166 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571193.1 | Gene: | hoxb4a / 30340 | ZFINID: | ZDB-GENE-990415-105 | Length: | 246 | Species: | Danio rerio |
Alignment Length: | 217 | Identity: | 56/217 - (25%) |
---|---|---|---|
Similarity: | 85/217 - (39%) | Gaps: | 53/217 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DQNFYHHPLPHTHT----HPH--------------PHSHPHPH---SHPHPHHQH---------- 40
Fly 41 PQLQLPPQFRNPFDLLFDERTGAINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFT 105
Fly 106 SSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRR----HKIQSDQHKDQS--- 163
Fly 164 -YEGMP-LSPGMKQSDGDPPSL 183 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bcd | NP_788587.1 | Homeobox | 106..153 | CDD:278475 | 20/50 (40%) |
hoxb4a | NP_571193.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 23..125 | 15/83 (18%) | |
Antp-type hexapeptide | 130..135 | 1/4 (25%) | |||
Homeobox | 154..207 | CDD:278475 | 23/52 (44%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 210..246 | 9/35 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.900 |