DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and hoxa2b

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_571181.1 Gene:hoxa2b / 30325 ZFINID:ZDB-GENE-990415-98 Length:363 Species:Danio rerio


Alignment Length:307 Identity:75/307 - (24%)
Similarity:108/307 - (35%) Gaps:96/307 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PPPDQNFYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNY 68
            |||    :...:|..:...||. |..|..:|:.....|...|||::.      :.:...|...|.
Zfish    49 PPP----FEQTIPSLNPGSHPR-HSRPKQNPNGSCPLPAASLPPEYP------WMKEKKASKKNQ 102

  Fly    69 IRPYLPNQMPKPDVFP---SEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADL 130
            .........|.|..|.   |.|:.|. .....||.||.:|::|:.|||:.|...:||..||..::
Zfish   103 TTSTAATTDPGPLYFSPQGSPEISDG-GSGATRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEI 166

  Fly   131 SAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPN 195
            :|.|.|...|||:||:|||.:||.|: |.|:..:           .||.||||:           
Zfish   167 AALLDLTERQVKVWFQNRRMKHKRQT-QCKENHH-----------GDGKPPSLE----------- 208

  Fly   196 ALTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQANRHMHMQYPSGGGPGPGSTNVNGGQFF 260
                                                           ..||.|.|.:      ||
Zfish   209 -----------------------------------------------EAGGRGDGKS------FF 220

  Fly   261 QQQQVHNHQQQLHHQGNHVPHQMQQQQQQAQQQQY-HHFDFQQKQAS 306
            :|...:.....|..:|    :..||....:||.|. |:.|.|....|
Zfish   221 EQVANNVSGALLEREG----YPFQQNTLTSQQSQNGHNSDSQSATVS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)
hoxa2bNP_571181.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..132 21/94 (22%)
Antp-type hexapeptide 88..93 0/10 (0%)
Homeobox 137..189 CDD:278475 23/51 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..218 15/101 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.