DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Pdx1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_074043.4 Gene:Pdx1 / 29535 RGDID:62387 Length:283 Species:Rattus norvegicus


Alignment Length:267 Identity:64/267 - (23%)
Similarity:100/267 - (37%) Gaps:84/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFR--------------NPFDL--LFD 58
            |...|:|....:|....:......|.|         ||||.              :|:::  |.|
  Rat    20 FQRGPVPEFSANPPACLYMGRQPPPPP---------PPQFAGSLGTLEQGSPPDISPYEVPPLAD 75

  Fly    59 ERTGAINYNYIRPYLPNQM----PKPDVFPSE------ELPDSLVMRRP---------------- 97
            :..||    ::..:||.|:    |.|..||:.      |.|..:.:..|                
  Rat    76 DPAGA----HLHHHLPAQLGLAHPPPGPFPNGTETGGLEEPSRVHLPFPWMKSTKAHAWKSQWAG 136

  Fly    98 ----------RRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRH 152
                      :||||.:|.:|:.|||:.||..:|::.||..:|:..|.|....:||||:|||.:.
  Rat   137 GAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKW 201

  Fly   153 KIQSDQHKDQ-------------------SYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNALT 198
            |.:.|:.:..                   |.|.:...|......|..||....:...|..|:.|:
  Rat   202 KKEEDKKRSSGTTSGGGGGEEPEQDCAVTSGEELLALPPPPPPGGAVPSGVPAAAREGRLPSGLS 266

  Fly   199 PSPTPST 205
            .||.||:
  Rat   267 ASPQPSS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 19/46 (41%)
Pdx1NP_074043.4 Transactivation domain 13..73 11/61 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..81 11/57 (19%)
Antp-type hexapeptide 118..123 1/4 (25%)
Homeobox 149..203 CDD:395001 23/53 (43%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 15/73 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.