DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Hoxd4

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001099355.1 Gene:Hoxd4 / 288153 RGDID:1309690 Length:251 Species:Rattus norvegicus


Alignment Length:209 Identity:57/209 - (27%)
Similarity:82/209 - (39%) Gaps:38/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QPP---PDQNFYHHPL----PHTHTHPHPHSHPHPHSHPHPHHQHP--QLQLPPQFRNPFDLLFD 58
            |||   |..:|...|.    |...:......|....|.|..|:..|  ....||....|......
  Rat    47 QPPGLYPRPDFGEQPFGGGGPGPGSALPARGHGQEPSGPGSHYSAPGEPCPAPPPAPLPGARACS 111

  Fly    59 ERTG-------------AINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIA 110
            :.||             |:.|.:::....|.: .|:....|          |:|:||.:|..|:.
  Rat   112 QPTGPKQPPPGTALKQPAVVYPWMKKVHVNSV-NPNYTGGE----------PKRSRTAYTRQQVL 165

  Fly   111 ELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQ 175
            |||:.|...||||..|..:::..|.|...|:||||:|||.:.|   ..||..:.:|...|.....
  Rat   166 ELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWK---KDHKLPNTKGRSSSSSSSC 227

  Fly   176 SDGDPPS--LQTLS 187
            |....||  ||.::
  Rat   228 SSSAAPSQHLQPMA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)
Hoxd4NP_001099355.1 Homeobox 155..209 CDD:395001 24/56 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.