DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Hoxd3

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001257967.1 Gene:Hoxd3 / 288152 RGDID:1588601 Length:432 Species:Rattus norvegicus


Alignment Length:232 Identity:65/232 - (28%)
Similarity:92/232 - (39%) Gaps:67/232 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQ 162
            :|.||.:||:|:.|||:.|...|||..||..:::..|.|...|:||||:|||.::|      |||
  Rat   195 KRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYK------KDQ 253

  Fly   163 SYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNA----LTPSP-----TPSTP------------ 206
            ..:|:..||..:..:..||      |||.|...|    |.|.|     .||.|            
  Rat   254 KAKGILHSPAGQSPERSPP------LGGAAGHVAYSGQLPPVPGLAYDAPSPPAFAKSQPNMYGL 312

  Fly   207 ---TAHMT-------EHYSESFNAYYNYNGGHNHAQANRHMHMQYPSG---------GGP----- 247
               ||.::       .:.:..|..:...:.|...|.||......|..|         .||     
  Rat   313 AAYTAPLSSCLPQQKRYAAPEFEPHPMASNGGGFASANLQGSPVYVGGNFVDSMAPASGPVFNLG 377

  Fly   248 ---GPGSTNVNGGQFFQQQQVHNHQQQLHHQGNHVPH 281
               .|.|.:|:   :....|:..:    ||.|...||
  Rat   378 HLSHPSSASVD---YSCAAQIPGN----HHHGPCDPH 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 21/46 (46%)
Hoxd3NP_001257967.1 Homeobox 198..251 CDD:395001 25/58 (43%)
DUF4074 369..430 CDD:404218 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.