DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and ind

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:227 Identity:57/227 - (25%)
Similarity:85/227 - (37%) Gaps:78/227 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PHTHTHP----HPHS------------------HPHPHSHPHPHHQHPQLQLPP---QFRNP--- 52
            ||..:.|    ||::                  :|.|....:|:.|    ||||   .:.:|   
  Fly    96 PHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQ----QLPPIHNLYGSPVVG 156

  Fly    53 -----------------------FDLLFDERTGAINYNYIRPYLPNQMPKPDVF---PSEELP-- 89
                                   :...|||..|. .:.:.....||..|..:..   |.|..|  
  Fly   157 GLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGK-RFKHESSCSPNSSPLKNHSSGGPVEITPLI 220

  Fly    90 ----DSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRR 150
                ||     .:|.||.|||:|:.|||:.|....||:..|..:::.:|.|...||||||:|||.
  Fly   221 NDYADS-----SKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRV 280

  Fly   151 RHK--------IQSDQHKDQSYEGMPLSPGMK 174
            :.|        .....:.:.|.:..|:||.:|
  Fly   281 KQKKGGSESPTFNLSTNSNGSPQASPVSPQVK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)
indNP_996087.2 Homeobox 231..283 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439767
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.