DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and GBX1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001092304.1 Gene:GBX1 / 2636 HGNCID:4185 Length:363 Species:Homo sapiens


Alignment Length:181 Identity:47/181 - (25%)
Similarity:65/181 - (35%) Gaps:60/181 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PKPDVFPS------EELPDSLVMRRP----RRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSA 132
            |||.:..|      |..|.:..:..|    ||.||.|||.|:.|||:.|...:||:....:.::.
Human   232 PKPKLKGSLGTGAEEGAPVTAGVTAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAH 296

  Fly   133 KLALGTAQVKIWFKNRRRRHK-IQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNA 196
            .|.|...||||||:|||.:.| |::.....:|              |:|.          ..|..
Human   297 ALKLSEVQVKIWFQNRRAKWKRIKAGNVSSRS--------------GEPV----------RNPKI 337

  Fly   197 LTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQANRHMHMQYPSGGGP 247
            :.|.|.                         |.:..|.|..|.|...|..|
Human   338 VVPIPV-------------------------HVNRFAVRSQHQQMEQGARP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 19/46 (41%)
GBX1NP_001092304.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..265 9/32 (28%)
Homeobox 264..317 CDD:306543 23/52 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.