DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and GSX1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_663632.1 Gene:GSX1 / 219409 HGNCID:20374 Length:264 Species:Homo sapiens


Alignment Length:198 Identity:53/198 - (26%)
Similarity:72/198 - (36%) Gaps:62/198 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PPPDQNFYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNY 68
            ||....:.|.||...|:...|.....|.:                          ....|..|..
Human    84 PPFGSQYCHAPLGRQHSAVSPGVAHGPAA--------------------------AAAAAALYQT 122

  Fly    69 IRPYLPNQMPKPDVF-------PSEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPR 126
            ..|     :|.|..|       .|.:||.|      :|.||.|||:|:.|||:.|....||:..|
Human   123 SYP-----LPDPRQFHCISVDSSSNQLPSS------KRMRTAFTSTQLLELEREFASNMYLSRLR 176

  Fly   127 LADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGG 191
            ..:::..|.|...||||||:|||.:||   .:.|..::.|     |.....|          |||
Human   177 RIEIATYLNLSEKQVKIWFQNRRVKHK---KEGKGSNHRG-----GGGGGAG----------GGG 223

  Fly   192 ATP 194
            :.|
Human   224 SAP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)
GSX1NP_663632.1 SNAG domain. /evidence=ECO:0000250 1..20
Homeobox 151..204 CDD:395001 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..264 10/44 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.