DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Pdx1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus


Alignment Length:275 Identity:66/275 - (24%)
Similarity:103/275 - (37%) Gaps:99/275 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFR--------------NPFD---LLF 57
            |...|:|....:|....:......|.|         ||||.              :|::   |..
Mouse    20 FQRGPVPEFSANPPACLYMGRQPPPPP---------PPQFTSSLGSLEQGSPPDISPYEVPPLAS 75

  Fly    58 DERTGAINYNYIRPYLPNQM----PKPDVFPSE------ELPDSLVMRRP--------------- 97
            |:..||    ::..:||.|:    |.|..||:.      |.|:.:.:..|               
Mouse    76 DDPAGA----HLHHHLPAQLGLAHPPPGPFPNGTEPGGLEEPNRVQLPFPWMKSTKAHAWKGQWA 136

  Fly    98 -----------RRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRR 151
                       :||||.:|.:|:.|||:.||..:|::.||..:|:..|.|....:||||:|||.:
Mouse   137 GGAYTAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMK 201

  Fly   152 HKIQSDQHKDQSYEGMPLSPGMKQSDGDPP-------------SLQTLSLGGGAT---------- 193
            .|.:.|:.:.   .|.|...|    .|:.|             ::..|...|||.          
Mouse   202 WKKEEDKKRS---SGTPSGGG----GGEEPEQDCAVTSGEELLAVPPLPPPGGAVPPGVPAAVRE 259

  Fly   194 ---PNALTPSPTPST 205
               |:.|:.||.||:
Mouse   260 GLLPSGLSVSPQPSS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 19/46 (41%)
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73 11/61 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116 21/98 (21%)
Antp-type hexapeptide 119..124 1/4 (25%)
Homeobox 150..203 CDD:278475 23/52 (44%)
Nuclear localization signal 198..204 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.