DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Nkx2-2

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_035049.1 Gene:Nkx2-2 / 18088 MGIID:97347 Length:273 Species:Mus musculus


Alignment Length:193 Identity:53/193 - (27%)
Similarity:83/193 - (43%) Gaps:56/193 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NQMPKPDVFPSEELPDSLV--------MRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLS 131
            ::.|:|.   ::|.||:..        ..:.|:.|..|:.:|..|||:.|.|.|||:||....|:
Mouse   101 SKSPEPS---ADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLA 162

  Fly   132 AKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSP---------GMKQSDGDP-PSLQTL 186
            :.:.|...||||||:|.|.:.|      :.::.:||.::|         .:...||.| .:|:..
Mouse   163 SLIRLTPTQVKIWFQNHRYKMK------RARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQ 221

  Fly   187 SLGGGATPNALTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQANRHM--HMQYPSGGGP 247
            .| ..||..|..|                  |:||        .||:.:||  :.||.|...|
Mouse   222 DL-AAATFQAGIP------------------FSAY--------SAQSLQHMQYNAQYSSASTP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 21/46 (46%)
Nkx2-2NP_035049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..131 6/32 (19%)
Homeobox 131..185 CDD:395001 24/59 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.