Sequence 1: | NP_788587.1 | Gene: | bcd / 40830 | FlyBaseID: | FBgn0000166 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036012267.1 | Gene: | Meox1 / 17285 | MGIID: | 103220 | Length: | 271 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 44/195 - (22%) |
---|---|---|---|
Similarity: | 66/195 - (33%) | Gaps: | 70/195 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 280 PHQMQQQQQQAQQQQYHHFDFQQKQASACRVLVKDEPEADYNF---NSSYYMRSGMSGATASASA 341
Fly 342 VARGAASPGSEVYEPLTPKNDESPSLCGIGIGGPCAI---AVGETEAADDMDDGTSKKTTLQIL- 402
Fly 403 -EPLKGLDKSCDDGSSDDMSTGIRALAGTGNRG---AAFAKFG------------KPSPPQGPQP 451
Fly 452 451 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bcd | NP_788587.1 | Homeobox | 106..153 | CDD:278475 | |
Meox1 | XP_036012267.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |