DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Meox1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_036012267.1 Gene:Meox1 / 17285 MGIID:103220 Length:271 Species:Mus musculus


Alignment Length:195 Identity:44/195 - (22%)
Similarity:66/195 - (33%) Gaps:70/195 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 PHQMQQQQQQAQQQQYHHFDFQQKQASACRVLVKDEPEADYNF---NSSYYMRSGMSGATASASA 341
            ||.:.:.::...:|   |..|.|              ..|::|   .:...:..|.:|     ||
Mouse    69 PHSLPRTERIFNEQ---HPAFPQ--------------TPDWHFPISEAGQRLNLGPAG-----SA 111

  Fly   342 VARGAASPGSEVYEPLTPKNDESPSLCGIGIGGPCAI---AVGETEAADDMDDGTSKKTTLQIL- 402
            ...||.|||..         |.:     .|:|..|.:   ...|||.....   ..|:.:.|.| 
Mouse   112 REMGAGSPGLV---------DGT-----AGLGEDCMVLGTIANETEKKSSR---RKKERSGQSLV 159

  Fly   403 -EPLKGLDKSCDDGSSDDMSTGIRALAGTGNRG---AAFAKFG------------KPSPPQGPQP 451
             ||...:: :|:.||:       ....|.|.||   .:|:||.            |..|.|.|.|
Mouse   160 PEPEDEVE-TCEGGSA-------CVPTGAGPRGWGLCSFSKFRVRCSKDQNQERLKEPPLQFPPP 216

  Fly   452  451
            Mouse   217  216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475
Meox1XP_036012267.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.