DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Hoxd3

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_034598.2 Gene:Hoxd3 / 15434 MGIID:96207 Length:433 Species:Mus musculus


Alignment Length:324 Identity:80/324 - (24%)
Similarity:118/324 - (36%) Gaps:87/324 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PHPHSHPHPHSHPHPHHQHPQLQLPPQF-RNPFDLLFDERT-GAIN------------YNYIRPY 72
            |..:|...|...|.|    |...|||.. .||...:..::| |.::            :.:::..
Mouse   108 PGLNSEQQPPQPPPP----PPPTLPPSSPTNPGSGVPAKKTKGGLSASSSSSTISKQIFPWMKES 168

  Fly    73 LPNQMPKPDVFPSEELPDSLVMRRP--RRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLA 135
            ..|...|.....|.|..:......|  :|.||.:||:|:.|||:.|...|||..||..:::..|.
Mouse   169 RQNSKQKNSCATSGENCEDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLN 233

  Fly   136 LGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGA-------- 192
            |...|:||||:|||.::|      |||..:|:..||..:..:..||      |||.|        
Mouse   234 LTERQIKIWFQNRRMKYK------KDQKAKGILHSPAGQSPERSPP------LGGAAGHVAYSGQ 286

  Fly   193 ---TPNALTPSPTP-----STPTAHMTEHY---------------SESFNAYYNYNGGHNHAQAN 234
               .|.....:|:|     |.|..:....|               :..|..:...:.|...|.||
Mouse   287 LPPVPGLAYDAPSPPAFAKSQPNMYGLAAYTAPLSSCLPQQKRYPAPEFEPHPMASNGGGFASAN 351

  Fly   235 RHMHMQYPSG---------GGP--------GPGSTNVNGGQFFQQQQVHNHQQQLHHQGNHVPH 281
            ......|..|         .||        .|.|.:|:   :....|:..:    ||.|...||
Mouse   352 LQGSPVYVGGNFVDSMAPTSGPVFNLGHLSHPSSASVD---YSCAAQIPGN----HHHGPCDPH 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 21/46 (46%)
Hoxd3NP_034598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..198 18/93 (19%)
Antp-type hexapeptide 161..166 0/4 (0%)
Homeobox 199..251 CDD:278475 24/51 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..280 9/27 (33%)
DUF4074 370..431 CDD:290032 11/46 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..433 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.