DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Hoxd1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus


Alignment Length:141 Identity:41/141 - (29%)
Similarity:58/141 - (41%) Gaps:29/141 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNYIRPYLPNQM 77
            ||.|.....|.|.:.|.|.|        |...||.. .:.|:.:..:|..               
Mouse   174 HPGPFQTVSPAPGACPKPAS--------PTSSLPAA-HSTFEWMKVKRNA--------------- 214

  Fly    78 PKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVK 142
            ||     ..:|.:......|...||.|::.|:.|||:.|...:|||..|..:::..|.|...|||
Mouse   215 PK-----KSKLSEYGATSPPSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVK 274

  Fly   143 IWFKNRRRRHK 153
            |||:|||.:.|
Mouse   275 IWFQNRRMKQK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134
Antp-type hexapeptide 204..209 1/4 (25%)
Homeobox 233..285 CDD:278475 23/51 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.