DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Hoxb7

DIOPT Version :10

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus


Alignment Length:82 Identity:29/82 - (35%)
Similarity:44/82 - (53%) Gaps:7/82 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQ 162
            :|.|.|:|..|..|||:.|...||||..|..:::..|.|...|:||||:|||.:.|      |:.
Mouse   138 KRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWK------KEN 196

  Fly   163 SYEGMPLSPGMKQSDGD 179
            ...| |.:.|..:::.:
Mouse   197 KTSG-PGTTGQDKAEAE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeodomain 106..153 CDD:459649 20/46 (43%)
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131
Homeodomain 138..194 CDD:459649 25/61 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 5/28 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.