DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Hoxb4

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus


Alignment Length:189 Identity:48/189 - (25%)
Similarity:69/189 - (36%) Gaps:59/189 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AQPPPDQNFYHHPLPHTHTHPHPHSH---PHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGA 63
            :.|||.      |......||.| ||   ..|..:|.....|                    ...
Mouse   114 SSPPPP------PCAQNPLHPSP-SHSACKEPVVYPWMRKVH--------------------VST 151

  Fly    64 INYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLA 128
            :|.||                        ....|:|:||.:|..|:.|||:.|...||||..|..
Mouse   152 VNPNY------------------------AGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRV 192

  Fly   129 DLSAKLALGTAQVKIWFKNRRRR----HKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSL 183
            :::..|.|...|:||||:|||.:    ||:.:.:.:.....|....| ..:.:|.||:|
Mouse   193 EIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGTAGAAGGP-PGRPNGGPPAL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/50 (40%)
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133 8/25 (32%)
Antp-type hexapeptide 140..145 1/4 (25%)
Homeobox 164..218 CDD:395001 23/53 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.