DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and Gbx2

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_034392.1 Gene:Gbx2 / 14472 MGIID:95668 Length:348 Species:Mus musculus


Alignment Length:151 Identity:43/151 - (28%)
Similarity:59/151 - (39%) Gaps:33/151 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LPNQMPKPDVFPS---EELPDS-------LVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRL 127
            ||.|....:..|.   ||.|.|       ....:.||.||.|||.|:.|||:.|...:||:....
Mouse   213 LPGQTAHKEEDPGHALEETPQSGGAAGSTTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTER 277

  Fly   128 ADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGA 192
            :.::..|.|...||||||:|||.:.|              .:..|...|....||         .
Mouse   278 SQIAHALKLSEVQVKIWFQNRRAKWK--------------RVKAGNANSKTGEPS---------R 319

  Fly   193 TPNALTPSPTPSTPTAHMTEH 213
            .|..:.|.|...:..|..::|
Mouse   320 NPKIVVPIPVHVSRFAIRSQH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 19/46 (41%)
Gbx2NP_034392.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 10/37 (27%)
Homeobox 250..304 CDD:395001 24/67 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.